PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g59410.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family Nin-like
Protein Properties Length: 215aa    MW: 24719.5 Da    PI: 6.9053
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g59410.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK77.41.7e-2497144552
            RWP-RK   5 isledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       +++e +s++F  pik+AA eL+v+lT LKr+CR++GI+RWPhRk++sl
  Bradi3g59410.4.p  97 LTFELVSQHFCVPIKQAAAELKVGLTQLKRRCRELGIPRWPHRKMRSL 144
                       89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.08678165IPR003035RWP-RK domain
PfamPF020429.5E-2297144IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MYPLPQWSIE YLQEESPFFS TQHRLCTSTA TATQSYFCQD ELYALFQGDI LSLWAALEEE  60
APCKSEKELE LEQKLGPDAV EKTRMSNGPP EQEKPLLTFE LVSQHFCVPI KQAAAELKVG  120
LTQLKRRCRE LGIPRWPHRK MRSLQTLIDN VQELGRGTGE DGGMTKIVVE MLQQTKKLME  180
ERPGDVELDH TTKMLRQKCF KENYKRKRLM ALQG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014756209.11e-151PREDICTED: protein RKD1-like
SwissprotQ9M9U95e-31RKD1_ARATH; Protein RKD1
TrEMBLI1IFB61e-158I1IFB6_BRADI; Uncharacterized protein
STRINGBRADI3G59410.11e-157(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-32RWP-RK domain-containing protein